PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_34959_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 241aa    MW: 27721.1 Da    PI: 6.2306
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_34959_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.11.8e-17249148
                                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                         +g WT +Ed++lvd+v+ +G g W+  a++ g++R++k+c++rw++yl
  cra_locus_34959_iso_1_len_721_ver_3  2 KGHWTSQEDKILVDYVRIHGEGKWRDLAQKTGLKRCGKSCRLRWLNYL 49
                                         789*******************************************97 PP

2Myb_DNA-binding47.25.1e-155799347
                                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                      Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                                         + +++E++l+++++++lG++ W++Ia +++ gR+++++k++w++ 
  cra_locus_34959_iso_1_len_721_ver_3 57 NISEDEEDLIIKLHRLLGNR-WTLIAGRLP-GRSGNEIKNYWNTT 99
                                         6699****************.*********.************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007174.2E-13151IPR001005SANT/Myb domain
PROSITE profilePS5129425.705153IPR017930Myb domain
PfamPF002492.1E-15249IPR001005SANT/Myb domain
SuperFamilySSF466893.52E-28296IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.7E-22356IPR009057Homeodomain-like
CDDcd001672.11E-10549No hitNo description
SMARTSM007175.0E-1454102IPR001005SANT/Myb domain
PROSITE profilePS5129418.79754104IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.0E-2257104IPR009057Homeodomain-like
PfamPF002497.3E-145799IPR001005SANT/Myb domain
CDDcd001671.02E-1059100No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
XKGHWTSQED KILVDYVRIH GEGKWRDLAQ KTGLKRCGKS CRLRWLNYLR PGIKLGNISE  60
DEEDLIIKLH RLLGNRWTLI AGRLPGRSGN EIKNYWNTTL SKKIVADEKN HNHNMTVTMQ  120
TQTDELEDDK KILLLSSSSD HDESVVANVS DPPPSLQHQP KGPNNTVKRS SITGCNNNNN  180
NNNDDDDFMS FWNMDFFSSP PPPHDQKAHQ EENRNNSHDH EVELQAIHEG EFDFSFDIFS  240
X
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-24210427128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A067L0J82e-56A0A067L0J8_JATCU; MYB family protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154